Loading...
Statistics

Andrea Wolff Fine Art Photography
www.andreawolff.com/
Andrea Wolff Fine Art Photography New York photographer

Andreawolff.com

Andreawolff.com is hosted in United States / Scottsdale . Andreawolff.com doesn't use HTTPS protocol. Number of used technologies: 4. First technologies: CSS, Html, Javascript, Number of used javascripts: 3. First javascripts: Respond.min.js, Josefin-sans:n1...6,n7,i7.js, Jquery.min.js, Number of used analytics tools: 1. First analytics tools: Google Analytics, Its server type is: Apache.

Technologies in use by Andreawolff.com

Technology

Number of occurences: 4
  • CSS
  • Html
  • Javascript
  • jQuery

Javascripts

Number of occurences: 3
  • respond.min.js
  • josefin-sans:n1,i1,n3,i3,n4,i4,n6,i6,n7,i7.js
  • jquery.min.js

Analytics

Number of occurences: 1
  • Google Analytics

Server Type

  • Apache

Google Analytics ID

  • UA-571818-4

Conversion rate optimization

visitors Clickable call number Not founded!
visitors Conversion form (contact form, subcriber) Not founded!
visitors Clickable email Not founded!
visitors CTA (call to action) button Not founded!
visitors List Founded!
visitors Image Not founded!
visitors Enhancement Not founded!
visitors Responsive website Founded!
visitors Facebook sharing Not founded!
visitors Google+ sharing Not founded!
visitors Twitter sharing Not founded!
visitors Linkedin sharing Not founded!
visitors Blog on the webiste Not founded!

HTTPS (SSL) - Andreawolff.com

Missing HTTPS protocol.

    Meta - Andreawolff.com

    Number of occurences: 7
    • Name:
      Content: text/html; charset=utf-8
    • Name: robots
      Content: index, follow
    • Name: viewport
      Content: width=device-width, initial-scale=1
    • Name: Keywords
      Content: andrea,wolff,book,Fine art,color,photography,gallery,artist,show,contemporary
    • Name: dcterms.rights
      Content: Copyright 2012-2014 Andrea Wolff All Rights Reserved
    • Name: verify-v1
      Content: xxx=
    • Name: Description
      Content: Andrea Wolff Fine Art Photography New York photographer

    Server / Hosting

    • IP: 72.167.131.38
    • Latitude: 33.61
    • Longitude: -111.89
    • Country: United States
    • City: Scottsdale

    Rname

    • ns08.domaincontrol.com
    • ns07.domaincontrol.com
    • mailstore1.secureserver.net
    • smtp.secureserver.net

    Target

    • dns.jomax.net

    HTTP Header Response

    HTTP/1.1 200 OK Date: Wed, 27 Jul 2016 03:44:16 GMT Server: Apache Accept-Ranges: bytes Cache-Control: max-age=2592000 Expires: Fri, 26 Aug 2016 03:44:16 GMT Vary: Accept-Encoding,User-Agent Content-Length: 16447 Content-Type: text/html; charset=utf-8 X-Cache: MISS from s_sr109 X-Cache-Lookup: MISS from s_sr109:80 Via: 1.1 s_sr109 (squid/3.5.14) Connection: keep-alive

    DNS

    host: andreawolff.com
    1. class: IN
    2. ttl: 3600
    3. type: A
    4. ip: 72.167.131.38
    host: andreawolff.com
    1. class: IN
    2. ttl: 3600
    3. type: NS
    4. target: ns08.domaincontrol.com
    host: andreawolff.com
    1. class: IN
    2. ttl: 3600
    3. type: NS
    4. target: ns07.domaincontrol.com
    host: andreawolff.com
    1. class: IN
    2. ttl: 3600
    3. type: SOA
    4. mname: ns07.domaincontrol.com
    5. rname: dns.jomax.net
    6. serial: 2016050300
    7. refresh: 28800
    8. retry: 7200
    9. expire: 604800
    10. minimum-ttl: 3600
    host: andreawolff.com
    1. class: IN
    2. ttl: 3600
    3. type: MX
    4. pri: 10
    5. target: mailstore1.secureserver.net
    host: andreawolff.com
    1. class: IN
    2. ttl: 3600
    3. type: MX
    4. pri: 0
    5. target: smtp.secureserver.net
    host: andreawolff.com
    1. class: IN
    2. ttl: 3600
    3. type: TXT
    4. txt: google-site-verification=kaDLQVCNv8p7CDbOALb2zrniMV4mxxSf6OWZwowxF_U
    5. entries: Array

    Common Typos/Mistakes

    This list shows You some spelling mistakes at internet search for this domain.

    www.ndreawolff.com, www.aondreawolff.com, www.ondreawolff.com, www.apndreawolff.com, www.pndreawolff.com, www.a9ndreawolff.com, www.9ndreawolff.com, www.andreawolff.com, www.ndreawolff.com, www.aindreawolff.com, www.indreawolff.com, www.aundreawolff.com, www.undreawolff.com, www.adreawolff.com, www.anndreawolff.com, www.andreawolff.com, www.anhdreawolff.com, www.ahdreawolff.com, www.anjdreawolff.com, www.ajdreawolff.com, www.ankdreawolff.com, www.akdreawolff.com, www.anldreawolff.com, www.aldreawolff.com, www.an dreawolff.com, www.a dreawolff.com, www.anreawolff.com, www.andtreawolff.com, www.antreawolff.com, www.andgreawolff.com, www.angreawolff.com, www.andbreawolff.com, www.anbreawolff.com, www.andxreawolff.com, www.anxreawolff.com, www.andsreawolff.com, www.ansreawolff.com, www.andfreawolff.com, www.anfreawolff.com, www.andvreawolff.com, www.anvreawolff.com, www.andyreawolff.com, www.anyreawolff.com, www.andzreawolff.com, www.anzreawolff.com, www.andareawolff.com, www.anareawolff.com, www.andereawolff.com, www.anereawolff.com, www.andrreawolff.com, www.anrreawolff.com, www.andeawolff.com, www.andrieawolff.com, www.andieawolff.com, www.androeawolff.com, www.andoeawolff.com, www.andrleawolff.com, www.andleawolff.com, www.andrleawolff.com, www.andleawolff.com, www.andr.eawolff.com, www.and.eawolff.com, www.andrawolff.com, www.andrexawolff.com, www.andrxawolff.com, www.andresawolff.com, www.andrsawolff.com, www.andrewawolff.com, www.andrwawolff.com, www.andrerawolff.com, www.andrrawolff.com, www.andrefawolff.com, www.andrfawolff.com, www.andrevawolff.com, www.andrvawolff.com, www.andrecawolff.com, www.andrcawolff.com, www.andreqawolff.com, www.andrqawolff.com, www.andreaawolff.com, www.andraawolff.com, www.andreyawolff.com, www.andryawolff.com, www.andrewolff.com, www.andreaowolff.com, www.andreowolff.com, www.andreapwolff.com, www.andrepwolff.com, www.andrea9wolff.com, www.andre9wolff.com, www.andreawolff.com, www.andrewolff.com, www.andreaiwolff.com, www.andreiwolff.com, www.andreauwolff.com, www.andreuwolff.com, www.andreaolff.com, www.andreaw olff.com, www.andrea olff.com, www.andreawcolff.com, www.andreacolff.com, www.andreawolff.com, www.andreaolff.com, www.andreawdolff.com, www.andreadolff.com, www.andreawfolff.com, www.andreafolff.com, www.andreawgolff.com, www.andreagolff.com, www.andreawbolff.com, www.andreabolff.com, www.andreawlff.com, www.andreawoblff.com, www.andreawblff.com, www.andreawohlff.com, www.andreawhlff.com, www.andreawoglff.com, www.andreawglff.com, www.andreawojlff.com, www.andreawjlff.com, www.andreawomlff.com, www.andreawmlff.com, www.andreawo lff.com, www.andreaw lff.com, www.andreawovlff.com, www.andreawvlff.com, www.andreawoff.com, www.andreawoluff.com, www.andreawouff.com, www.andreawol8ff.com, www.andreawo8ff.com, www.andreawol9ff.com, www.andreawo9ff.com, www.andreawoljff.com, www.andreawojff.com, www.andreawol0ff.com, www.andreawo0ff.com, www.andreawolmff.com, www.andreawomff.com, www.andreawolpff.com, www.andreawopff.com, www.andreawoloff.com, www.andreawooff.com, www.andreawolf.com, www.andreawolfqf.com, www.andreawolqf.com, www.andreawolff.com, www.andreawolf.com, www.andreawolfaf.com, www.andreawolaf.com, www.andreawolfyf.com, www.andreawolyf.com, www.andreawolftf.com, www.andreawoltf.com, www.andreawolfgf.com, www.andreawolgf.com, www.andreawolfbf.com, www.andreawolbf.com, www.andreawolfwf.com, www.andreawolwf.com, www.andreawolfsf.com, www.andreawolsf.com, www.andreawolfdf.com, www.andreawoldf.com, www.andreawolfrf.com, www.andreawolrf.com, www.andreawolf3f.com, www.andreawol3f.com, www.andreawolf4f.com, www.andreawol4f.com,

    Other websites we recently analyzed

    1. Last Minute Deals - Book cheap last minute travel, car rental, Holiday deals
      poshreservations.com offers amazing late travel deals. Huge savings on hotels, flights, holidays, city breaks, theatre tickets & spa. Book online now & save!
      Brea (United States) - 66.33.220.218
      Server software: Apache
      Technology: CSS, Html, Html5, Iframe, Javascript, Php, Google Analytics
      Number of Javascript: 3
      Number of meta tags: 4
    2. Surfis – Web Design – Web Programmierung – Web Marketing – Suchmaschinenoptimierung – Web Dienstleistungen
      Austria - 81.19.145.86
      Server software: Apache
      Technology: Carousel, CSS, Flexslider, Google Font API, Html, Html5, Javascript, jQuery, Php, Pingback, SuperFish, Google Analytics, Wordpress
      Number of Javascript: 15
      Number of meta tags: 3
    3. villa-service.de
      Dublin (Ireland) - 54.75.245.178
      Server software:
      Technology: CSS, Html
    4. Home
      Fine Art by Ed Lax
      United Kingdom - 78.110.160.2
      Server software: Apache
      Technology: CSS, Flexslider, Google Font API, Html, Html5, Javascript, jQuery Fancybox, Php, Google Analytics
      Number of Javascript: 22
      Number of meta tags: 4
    5. Mainstagebingo | Home
      Curacao - 190.121.210.6
      Server software: CXLWS
      Technology: CSS, Html, Html5, Javascript, jQuery Cookie, jQuery UI, Php, Swf Object, Google Analytics
      Number of Javascript: 15
      Number of meta tags: 1
    6. Lilabat.com Gros oeuvre & Bâtiment
      France - 213.186.33.40
      Server software: Apache
      Technology: CSS, Google Font API, Html, Html5, Wordpress
      Number of meta tags: 2
    7. Outdoor Bunting | Cheap union jack, birthday bunting for celebrations and lots more
      Germany - 82.165.184.170
      Server software: Apache
      Technology: CSS, Html, Html5, Javascript, Php, Pingback, Wordpress
      Number of meta tags: 3
    8. ippodromolamauramilano.info
      Registrazione e gestione dei domini Internet, i documenti necessari, le ultime estensioni possibili, il listino prezzi completo!
      Italy - 195.110.124.188
      Server software: Apache
      Technology: Html
      Number of meta tags: 3
    9. no-win-no-fee-lawyers.com.au
      Australia - 27.121.64.40
      Server software: Apache/2.2.31 (Unix) mod_ssl/2.2.31 OpenSSL/1.0.1e-fips mod_bwlimited/1.4
      Technology: Html
      Number of meta tags: 1
    10. antarvedisrilakshminarasimhaswamy.org
      See related links to what you are looking for.
      New York (United States) - 199.59.243.120
      Server software: Microsoft-IIS/7.5
      Technology: Google Adsense, Html, Html5, Javascript
      Number of meta tags: 3

    Check Other Websites